DPCstruct | MC36438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 156 ± 25 aa |
| Standard deviation of domain lengths | 25.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 22.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0UE32 | 1-145 | MTTPHILRLPVELHLGVIEMLELQDRVRLASANRYFRSITKPPSHIEYLKAEAESWAKDRDLFACSGCIRFRRFQDFSDDMKKGKRT… |
| A0A1Q5TCA8 | 3-137 | PFFRLPPELHVLITSFLPIEDQLQFRLTCAYIYDVIPPLSHEELLLAESTNWARRKDVYACRYCLRLRPASQFAESMLRRRRSREGR… |
| J3NR98 | 32-183 | None |
| A0A5N6U0H5 | 155-287 | None |
| C9SNX1 | 21-235 | None |
| Q2GUN8 | 114-271 | None |
| A0A084RZU5 | 43-181 | None |
| C4JNN9 | 73-256 | None |
| A0A084RL75 | 1-172 | None |
| A0A3D8RFI7 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.