DPCstruct | MC36433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 182 ± 23 aa |
| Standard deviation of domain lengths | 22.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20209 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096PF96 | 4-170 | DNDEEVREWKVVMDWWMGKCSFCAGRGVQGRQIEHTLRQCPNGGKRTLRSVLAESIHEEGFRAGGGCQRCALPREVCQAWEQDRSGA… |
| A0A1Q5SV21 | 12-212 | QLPASPSVGPRQRLEETDGDDDLGDLQAGAELLQTRIQEQARGLADYIGCLETWRGVCMICYHLPRVASGQVGHARHGLAGCVNPER… |
| A0A0F7ZR00 | 398-578 | None |
| A0A2K0TYV7 | 634-825 | None |
| A0A0J9WDK9 | 599-765 | None |
| A0A014PI63 | 552-727 | None |
| A0A545V159 | 376-559 | None |
| Q2H7V4 | 67-261 | None |
| A0A0F7ZHU1 | 476-653 | None |
| A0A0F7ZQT7 | 350-535 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.