DPCstruct | MC36431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9CSK3 | 1-71 | MEDLGTEKVLMDQRMGHIDGSVSARYAHVTPGMRKRLVLGLTEQWEAALAARLSMCPKSPVHVLDALLRVR |
| A0A1K0FGL6 | 3-109 | PGLTPHGQRHGYQTWMDEDGIPYVAQSQQMGHEVPGTRGIYSHVTDRMLNEIREALQERWMAALRARAALSPTSAVPVLHAALMALF… |
| A0A3D5DT16 | 27-140 | None |
| G8RZ87 | 132-237 | None |
| A0A221VYL8 | 15-110 | None |
| A0A7K1LB78 | 43-131 | None |
| A0A2W4MWE8 | 32-142 | None |
| A0A061A5N5 | 26-119 | None |
| A0A840WLP3 | 8-94 | None |
| A0A7K1L4R4 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.