DPCstruct | MC36428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 20 aa |
| Standard deviation of domain lengths | 20.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BD84 | 80-175 | EQAMLDALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCN… |
| A0A0K0CSN8 | 139-258 | MKDALRLNRVDFVECLLENGVSMKKFLTIATLEQLYNLDDDAQHNVRFLVEHSSPTSYMTLPDIGLIIEKLMGNAYKHYYTSRLFKN… |
| A0A0R3TG77 | 5-113 | None |
| A0A815AP31 | 75-192 | None |
| A0A448X3W6 | 46-141 | None |
| A0A060WVB0 | 319-426 | None |
| A0A6I9MTS7 | 41-197 | None |
| F1LN45 | 432-563 | None |
| A0A183WZ61 | 1-125 | None |
| A0A2H2IZX8 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.