DPCstruct | MC36427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 4 aa |
| Standard deviation of domain lengths | 4.15 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7I7A3 | 8-116 | FPSALPCPTPSHRGNYERYPPPRDPILPAVLEFREESEDGFLHAITTDLDPTDIQFKLAPTYTLYMAARFRASTHYRPDLSPTERAH… |
| A0A6A4XD89 | 36-139 | LRGHESYMERSTTYASYGRGSDAILPAVLEFREETEDAFLRAVISQLDPSSLQFKLAPTYTLYMSARFRASTHYRSELTPDERATKL… |
| A0A7J8K4G9 | 366-471 | None |
| A0A2P8ZDG9 | 200-299 | None |
| A0A7R9E3Q1 | 248-360 | None |
| A7SV26 | 553-654 | None |
| A0A2G8KXS8 | 463-564 | None |
| Q9QZQ1 | 571-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.