DPCstruct | MC36425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7BGE4 | 1-133 | MDDFDKSYKLPRRIEFRLGHSIVSATGKANDSKHLNVVHLSILRSPFERTLLALILRLPIFLQTLIATIFPGLFLPHRVVLKKVKPG… |
| A0A1V6TL45 | 501-600 | AIVYLHGEPIAARTLKALDQRRPTVLRLETEPSSCHNALPHNVKSIIVKQQKDGWASEFQREKEAYKTLEDLQRTVIPQLFGEGSLN… |
| A0A319E0B7 | 1-119 | None |
| A0A100IKL8 | 1-104 | None |
| A0A1V6SQH1 | 37-140 | None |
| B6H0M7 | 1-107 | None |
| A0A0U1LJ79 | 837-933 | None |
| S7ZWU5 | 2-99 | None |
| A0A229YEK2 | 423-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.