DPCstruct | MC3642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 160 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | CL0020- PF12816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5TLG6 | 4-166 | PKLIEIMRASLEYVFSDRRMEDDTHFDLDGRGVDRTELFEGLVRSCATACVAIDELDFIFDKMFEQYQEHGINTIFFLQLQPFILRS… |
| A0A0R3PJ37 | 338-495 | PSLLLEQLRRVLDITMSGCKEGKISDLVSHYKAYISILLAVCIGAQMRTFLYDEVWVELDPLSRLIFLESLDEFVLDGTLESPPPSI… |
| A0A7D8Z266 | 224-394 | None |
| A0A0D8XM48 | 439-594 | None |
| A0A815N560 | 2-158 | None |
| A0A3Q0J5Z7 | 411-573 | None |
| A0A287XR03 | 659-826 | None |
| H2ZS31 | 2-169 | None |
| A0A287XQN4 | 171-338 | None |
| A0A175VTU1 | 661-817 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.