DPCstruct | MC36417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 164 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7ZR96 | 9-182 | PLGIQFFYPKNLPALVTIVYLEDGDIRESFFRRLDPTEPSQSSVGKWSQHVGGFLASFNIGKALPVRMTVCWDSVIDKKAYETEIWF… |
| A0A8A7JXT9 | 1-114 | MPDKVVIEWVSYHDKKRYGITLDLPKDMAAQMARRYRVQVGGKWQEEQRNNIALGLASGGYVEVFLRNPKVKPDILLARGLATEVTD… |
| A0A1V9FZ88 | 211-397 | None |
| A0A2X2JF35 | 148-330 | None |
| A0A3M5KBD2 | 1-155 | None |
| A0A137SB99 | 2-142 | None |
| F2JUZ5 | 27-205 | None |
| A0A380ZY05 | 20-216 | None |
| A0A2T5XTV1 | 84-237 | None |
| A0A521BI37 | 85-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.