DPCstruct | MC36410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 207 ± 37 aa |
| Standard deviation of domain lengths | 37.45 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 48.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817L482 | 264-479 | DCIDRIRFLSWLMIGSLTHAAITRNEGTIICHPIPVDASQSIADYILYILTGFADQSKTSVIHMSSLFHSFILCQLWTMYCEQVNRG… |
| A0A6P4Z3Y4 | 31-223 | PCHPLPLDTSLQIADLALVVLESYPEHTKASVYQMSSLAQVFILCQLWTIYCEQVAVFNTSHGDMYRTTCLAVMEFWMKVAPTFIQI… |
| A0A833VLG2 | 268-478 | None |
| A0A085LJ51 | 81-287 | None |
| A0A1B6M9Q9 | 1-179 | None |
| A0A8B6BZP8 | 586-808 | None |
| A0A5K3EZ13 | 9-176 | None |
| W5JH62 | 527-757 | None |
| A0A183J7B2 | 3-186 | None |
| A0A6V7TTN6 | 115-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.