DPCstruct | MC3641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 324 ± 48 aa |
| Standard deviation of domain lengths | 48.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5TFV0 | 52-374 | LQPTSSDDRYFHERTPVDDAFFNGLPPAYNFADHGKSTGVATSSNNEKSRITRVPLLDRINLSKENNVHQLVFHKYIFRIPVSVDEL… |
| A0A5B0R2S1 | 19-276 | ASMENIQHPKFPRISFDKSIFIAEDGQGEKQTYHDLILGIIEKYGRDGKLVLKPNEFWDVSKSTKKNRTQKSAKKEPSVSRVNKYRI… |
| A0A2S4VML1 | 29-386 | None |
| A0A2N5W4R7 | 25-328 | None |
| A0A2S4W682 | 372-597 | None |
| A0A2S4VGD6 | 1-299 | None |
| A0A2S4VU29 | 774-1075 | None |
| A0A2N5UZ86 | 722-1049 | None |
| A0A2N5V2K5 | 230-602 | None |
| A0A2N5V5P0 | 123-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.