DPCstruct | MC36404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1TSI5 | 1-86 | MIAEPNIKIHKQCEDVDRSGRPLAQELCCTSCYCRPMWCVECLARWFAARQNEHEREVWLEQKCTCPMCRAKFCLLDVSYIEKPIP |
| A0A2J7QDR8 | 58-132 | QTPANVKLQKYCDDLTVQGDSCTTCSCRPLWCLTCMGKWFASRQDQNHPETWMSSKATCPLCRSRFCMLDVSQVQ |
| A0A2H1C2M3 | 186-270 | None |
| A0A4Z2FRJ4 | 205-280 | None |
| A0A0S7LQT6 | 35-110 | None |
| K7H329 | 234-318 | None |
| A0A0K0E0K8 | 282-357 | None |
| A0A0J9YVH4 | 1-74 | None |
| A0A819CSP8 | 624-696 | None |
| A0A7R8D5P1 | 501-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.