DPCstruct | MC36402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 352 ± 45 aa |
| Standard deviation of domain lengths | 45.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0265- PF04676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1TP65 | 1-322 | MKVKPVKMIPQVMIPTTLDLTNAKVQENLRRENQLTYVRRSWELKVGKRKVIRFNLQKQISCSSEVETSNSEEETGATTTKRFQLTD… |
| A0A1A8PG74 | 116-377 | METGQSFDESEEEEEELLLLSEEEMNKLGSKLIKAEMMGNTAMIEKLKSQLEAAHKAKENHAARIKQHETAESKKAAGHSSEDQEVL… |
| A0A7R9PSJ9 | 148-470 | None |
| A0A316U4R8 | 292-706 | None |
| A0A484AWZ6 | 102-493 | None |
| A0A498N6J4 | 224-573 | None |
| A0A1Y2HCL5 | 123-512 | None |
| Q16EN7 | 45-340 | None |
| A0A4U7KRH1 | 132-548 | None |
| A0A182SIK0 | 19-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.