DPCstruct | MC36400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RP91 | 1-132 | RMAYFHAELRLWTMKNSFAVKGTDIGCFHYHEKGEAVPPTSDFLYLEDKQRYAESRNYTWVPKNKRPEKLRETLKDLEELLQGSRCV… |
| A0A653DH11 | 1-143 | MVSLLNEIHFWTTQEDVITKYSDYVSFKYYAKKEADDSVPFHAKREYCDQRGLIWIPPNKRPQRLRDRIREFEEYLVHNRVIYFSWE… |
| A0A1A8N1Q2 | 1-156 | None |
| B3RW68 | 9-126 | None |
| A0A3B3RMG0 | 192-312 | None |
| F2UBA1 | 391-541 | None |
| A0A1Y1MRA4 | 1-125 | None |
| A0A7F5RL81 | 1-142 | None |
| A0A1V9XRX8 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.