DPCstruct | MC364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 277 ± 58 aa |
| Standard deviation of domain lengths | 57.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 20.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B8Q5 | 31-284 | LSIDHIHLLEEINKRTVLLEGPLVYRAIQRYEQLWLPLVAENHQQILAAPIDIEWIWHCHLLAPVMYHRDCENAVGQSINHQLLDGR… |
| A0A3P6GJN4 | 33-282 | AEANKHLQFLGVVDRNRWLYNAYRLPSLPKHYESSSICEEPLVPPIDCEWVWHCHRLDPVRYKSDCEEFYGRVLDNSGIVSSANGSC… |
| A0A369J6K5 | 2-456 | None |
| A0A1X2IBS3 | 24-401 | None |
| A0A819Z8E3 | 28-234 | None |
| A0A813AIV2 | 22-295 | None |
| A0A835Y6D9 | 10-324 | None |
| G3J4K1 | 7-384 | None |
| A0A5C6TLD5 | 13-352 | None |
| A0A819MH36 | 2-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.