DPCstruct | MC36399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 199 ± 42 aa |
| Standard deviation of domain lengths | 42.22 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4UZG9 | 2-148 | AFEIYYRKGRILLMLRALKRALALAPDSARLAAQLVRFRRLLDERQAQLSEPVRAVLAEAAPALFGDLSAQQLADRTVAQQPESLEH… |
| A0A4C1TGD6 | 61-242 | KFLTPLRTLAADRIDTHLMAFEIYYRKDKPLLMLQSVKRAHRLQPDHPQLRDCLLRFLERLDELRPALHQHVATVLDAETQPLFGER… |
| A0A446PTA2 | 105-380 | None |
| B7P5N3 | 29-275 | None |
| A0A2B4RBH8 | 424-581 | None |
| A0A6P5YFP2 | 47-215 | None |
| A0A6G0U403 | 63-278 | None |
| A0A814BPB3 | 583-845 | None |
| A0A5B7FAL8 | 25-179 | None |
| A0A0D8Y2K8 | 45-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.