DPCstruct | MC36396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.72 |
| Pfam Score | 79.17 |
| Assigned Pfam label(s) | CL0123- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1TA39 | 20-129 | KVDKIDDSVQHNLMNIANGKTDLTANLVADYKKRKLLQEVTTKSFILSKGSAFATSLTKLETDLTVDMLASGLWKDLKFKSYNFEAL… |
| H9JXS0 | 32-157 | KVDSITDIVQENLSEIRKGIDNLSENVRNDYKKRKLLQEVTIKSFLLSKGPQFAITIKKLETDLTSDMLLSGSWKTLEFKPYNFDAL… |
| E3KJB6 | 7-116 | None |
| A0A453PNK2 | 154-271 | None |
| A0A7J2J6F6 | 1-159 | None |
| A0A5B7D429 | 116-264 | None |
| A0A811LMT5 | 211-337 | None |
| A0A4Y7J054 | 630-750 | None |
| A0A7R9ARW4 | 46-170 | None |
| A0A653BHC1 | 92-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.