DPCstruct | MC36393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317PHM7 | 27-136 | DASNLPVIKPGSKEWKQAVNTMRNSGSSKPNFRVFDKTTAEKLLNEARPKTPEYPEYYGSKNYPDKTGFEHHPNESHTVNAPENNRP… |
| A0A7C4UCA4 | 4-97 | DAEVIQGIQGPGRYDAIVQDEATARRLLQTALPGAIELMPASAGQPYPSPPVGCLKWYQLHPAEPAVGHSKPHFKYVDWTGGKKGKG… |
| T0NAE2 | 6-95 | None |
| G8M2A2 | 18-118 | None |
| A0A7V8VGS3 | 48-149 | None |
| A0A7W9TWD6 | 4-108 | None |
| A0A242NEJ6 | 69-185 | None |
| A0A6H3TMJ9 | 2-85 | None |
| A0A1C6I0X7 | 68-164 | None |
| A1TSG3 | 266-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.