DPCstruct | MC36389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 368 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF07626- CL0318- PF07637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I6AH18 | 28-412 | AEATPAGIGQNERALLKSTCVDCHSGESAEAKLDLQQISFDLKDKTARHRWVQIYDRIAAGEMPPDPADLSAENRQALLESLSTALL… |
| A0A848WXT9 | 1-351 | MQPPSRTSTVEGEPGEIHFVNVWKSIAAVAAFFASDCAFGVDFEKDVRPVLQKLCFECHGPDTQKADIRFDTLSPDFLNGGGADTWH… |
| A0A2V8MMC9 | 18-409 | None |
| A0A6L8DYF3 | 18-344 | None |
| A6DTF2 | 276-650 | None |
| A0A2V8JZE1 | 2-389 | None |
| A0A7Y4TH71 | 1-385 | None |
| A0A2D5M9T7 | 399-733 | None |
| A0A2E8F3Z0 | 237-554 | None |
| A0A7C7WFH7 | 85-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.