DPCstruct | MC36387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 300 ± 37 aa |
| Standard deviation of domain lengths | 37.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A100WMD8 | 5-261 | GFLQRAVLLTVANPQCAERLWDMLDQLQPPPHHALFETAPALRTAMQALTDDLAEVEALLSSDDAALERFVRRSHAELTDLHNGRYD… |
| W4A8E3 | 78-402 | IQAIQGHAARVTGKYGIDRFRHEPAAILELENQQYKKPIIPRRPTEEMLTEIVRRMEGRTFVALLCGGSPQVEIHLRRIGQLKAKLL… |
| A0A6N4USR4 | 255-574 | None |
| I4BS80 | 9-228 | None |
| A0A1S6GKV6 | 1-327 | None |
| A0A1F7QW02 | 161-407 | None |
| A0A3S0S7T0 | 144-466 | None |
| A0A5A7Y6A6 | 3-328 | None |
| A0A810PEQ3 | 400-720 | None |
| A0A375YTA5 | 277-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.