DPCstruct | MC36386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 146 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8UTE4 | 3-110 | AIAAIHVLDLPGKLKETPYLGYLYIVLIVAALVIAERLFTVATKLDYLAAGALAAAVIVAFVINRTVGMPGATDDIGNWLEPLGLLS… |
| A0A538JTI4 | 37-203 | STPKPDGNESPPDFAAALQVAAACGLIVAALIHFAVVDVHFEEWLATGVFFVVLGVVEIGLAVAVLGWGRRRIYRVALLVTVGTLAL… |
| A0A1Q9T070 | 2-119 | None |
| A0A101NDN2 | 1-137 | None |
| A0A838JS10 | 28-146 | None |
| A0A3C1CG87 | 1-209 | None |
| A0A1Q3Q2V8 | 34-162 | None |
| A0A6J5YE90 | 16-179 | None |
| A0A4V4HQF4 | 42-226 | None |
| A0A542I675 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.