DPCstruct | MC36385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G8N9H7 | 4-86 | QAQREAQGAKAALEAQGIPVEEAKPGDISPLLALEEELQAHPGTYQAIVLATLPPGLSRWLRLDVHTQAERFGLPVIHVVAQP |
| A0A524N8Z0 | 30-116 | SDERQIARDRLAFGLEWLVSLGATATGELSVECDTAAAVARIIEVTPADEIIVSTLPTTISRWLHQDLPHRIERKVKLPVTVITGTA |
| A0A838V1X7 | 2-75 | None |
| A0A536S2G3 | 3-87 | None |
| A0A411YAM8 | 45-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.