DPCstruct | MC36381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 491 ± 50 aa |
| Standard deviation of domain lengths | 50.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 20.35 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF11856- CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2FA37 | 248-730 | LVNTPTKEALEAIDQMPAEGPTRRVMLLVFPHASAAKPASPVQGKVEQPSVISAVRSIMRAQSSQSNRTFVDEIEKYNRSAGARRGG… |
| A0A538IZR1 | 1-472 | MLDNKPFGPAVDAIRERPADVEVDRRLLYLEPDPGEERTASRQSAPGTAAAAIGGLTGLPRAEPILDDLVEIGALNERVHRIADIIQ… |
| G1XXT9 | 236-707 | None |
| A0A101JI93 | 163-704 | None |
| A0A329P9X9 | 4-386 | None |
| A0A5B7R9A3 | 256-750 | None |
| A0A5N5V9Z8 | 272-802 | None |
| A0A5J6F2C9 | 1-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.