DPCstruct | MC36380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379STB4 | 1-89 | MVGNVPDYHATLTHYADLADNKASAVPAPVYPGLFMLGALGSRGLCSAPLCAEILAAQMSNEPIPLDASTLAALNPNRLWVRKLLKG… |
| A0A351DQN1 | 8-119 | TAKDILGHRVSLRTATPDYAPIVGQIADPRDWDSRLDGLKYDASFQPSEALPYLNGQYVLAGLGSRGTLTAPITAELVVSQILGEVL… |
| I1DNU9 | 1-103 | None |
| A0A1J5Q558 | 102-192 | None |
| A0A0U1HGE7 | 7-113 | None |
| A0A850R7J1 | 320-415 | None |
| A0A839A1D8 | 353-440 | None |
| A0A484Z7M5 | 1-87 | None |
| A0A3T1DJI7 | 220-317 | None |
| A0A656ATL8 | 118-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.