DPCstruct | MC3638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 204 ± 21 aa |
| Standard deviation of domain lengths | 20.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 14.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7QLG0 | 284-450 | LSPSQSYGNLIANLRETTVELCIDQEGFRAIRPQFRLAGFSNPGQMHTGDAGGDTAEFIPVRRQSYSFHYATLDREPALRRITVNDD… |
| A0A2N5T5Y4 | 7-221 | FEKLPVEIVELCLEGLPASSIGALLGLSRQTRHLVLTSIEFIFAKMLKSFDEKKQYVGLEAVHTSLSVTDRSTLTFSNFVAVPNVST… |
| A0A2N5SJ70 | 62-285 | None |
| A0A261Y4P4 | 3-212 | None |
| A0A397IRG1 | 18-253 | None |
| A0A1X2G6A9 | 3-210 | None |
| A0A1B9HYG0 | 436-657 | None |
| A0A1X2HW24 | 25-203 | None |
| A0A1X2HC76 | 24-216 | None |
| A0A5B0RYG2 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.