DPCstruct | MC36378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9QWB5 | 7-97 | KLKSEILEATWHALKPHHERGALIVVQHPLELDDVGVAIALDRSPIVEHWMNEGLLYKPSDEHVQTWEEEERKFFWSVIVQPFVLAK… |
| A0A349X6D3 | 14-102 | LIRSTAKIKFSELQRFFAQGIMYVVAKEADLIDVATKMITDDKASIEELIENGVFKLAQDEQAREWLTDDTMLWCAVVAPYILVQEF… |
| A0A7Z2NU18 | 1-82 | None |
| A0A7Z9G9W7 | 1-82 | None |
| A0A2E9RGH7 | 158-241 | None |
| A0A5B8XM78 | 7-98 | None |
| A0A0E3Y9X3 | 19-119 | None |
| A0A378YR56 | 46-141 | None |
| C0ER98 | 1-60 | None |
| A0A2H0QGG8 | 4-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.