DPCstruct | MC36376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 151 ± 36 aa |
| Standard deviation of domain lengths | 35.51 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0015- CL0588- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3XV11 | 1-155 | MQLNNIKAHPGATKSKKRLGRGSGSGHGVTSGKGDKGQLARSGGSVRPGFEGGQMPLYRRVPKRGFNNFARRITAIVNIGDLDTFDF… |
| W0TG22 | 156-352 | SFVRHISILSSLKPSEGSIKGYKRLGRGPSSGKGKTSGRGQKGQKARGHVKSWFEGGQTPIYKLFPKLGFTNVTSLDLKELNLERIK… |
| A0A3Q2KWU4 | 7-111 | None |
| A0A7S4CTY7 | 163-338 | None |
| A0A2N2GZB5 | 2-151 | None |
| A0A822XZI2 | 74-193 | None |
| A0A556TYQ8 | 18-210 | None |
| A0A2P6NX82 | 55-234 | None |
| F8FA28 | 1-85 | None |
| A0A654H4J0 | 7-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.