DPCstruct | MC36375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 165 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8WQR0 | 44-229 | RKDADATNGFQEGTIVFGRAFEKGSGLDSQVTDGTNKSSSNAYEEDEGDYQADAAGWMSPTQVASPQDSSWKSMSPSLQCGSGQLKF… |
| A0A437CGT3 | 38-199 | QTNVAQRGDSKESSAVEVAKGSIFFDLKPSDNLCSSSGESDEMVKTDLIGMDHGIKEAEWRLLNASLQCGQTKMKLVVEGPGAADLE… |
| A0A5A9PP62 | 185-337 | None |
| A0A6F8ZVF8 | 39-212 | None |
| A0A7J6B695 | 22-176 | None |
| A0A5A9PQE2 | 271-418 | None |
| A0A5A9PP58 | 116-263 | None |
| A0A315VNN8 | 584-753 | None |
| A0A669C3M5 | 44-218 | None |
| A0A4W5PCX6 | 156-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.