DPCstruct | MC36371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 438 |
|---|---|
| Mean domain length (aa) | 171 ± 43 aa |
| Standard deviation of domain lengths | 42.54 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 27.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3HVF5 | 96-344 | NTDFVVTGYKNRYGDLRAAFGNDLEKYYRHYLDYGVDEKRDGSACDTVQNPITKYKGIDYKLVYNYATYKGNYEDLAKAFKDDDVAY… |
| A0A327M9D2 | 23-172 | QNPDVAQAGINPLQHFLDYGRSEGRAAHAAVGFDIRGGFDSEYYLLTNPTVGNAGMDALQHWHAYGWQAGVNPNYLFDTKYYLAQNP… |
| A0A6M1LVY5 | 140-347 | None |
| A0A7B7BWR2 | 122-290 | None |
| A0A538PWJ3 | 338-533 | None |
| A0A7W5Z4I3 | 401-594 | None |
| A0A2S7J9M3 | 57-239 | None |
| A0A5E8H1Q8 | 507-668 | None |
| A0A5E8H064 | 9-172 | None |
| A0A3A1P400 | 27-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.