DPCstruct | MC3637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 168 ± 19 aa |
| Standard deviation of domain lengths | 18.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3JXZ4 | 2-150 | TGRHNVPHGVIINTHVQCLEGSGPFHDIPDVVYDNMQYSVYDYQKYPNLSPVGFALEYFTPHKRTKSITKALENLMVLYGATNAGLR… |
| A0A2N5SZI6 | 1-187 | MPFPEEASNPDVGIKLVENNDEVIFAEKPCFVLGPGQYPFTPNPNVTCKEDGTRMIPPIPELSFKGIDYSAIHYRADLYTTPVMSAF… |
| A0A0L6V718 | 80-271 | None |
| Q0U306 | 1-147 | None |
| F4RAC4 | 13-169 | None |
| F4R909 | 28-213 | None |
| F4R8W9 | 152-350 | None |
| A0A180G421 | 25-197 | None |
| A0A084RQW9 | 11-181 | None |
| A0A5B0PFX8 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.