DPCstruct | MC36368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 410 ± 74 aa |
| Standard deviation of domain lengths | 73.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9ZZ94 | 62-549 | LPHTKPKATAYLNSRVGELSQREISEPNPLERFKNPRKHHDIIAMAQLIFQKTKSPAKFVEEVFRSIFGPEMRKFFNQKIQKFFRKH… |
| A0A0C3MZK6 | 230-840 | TSLQDRMWRMYRALADNPNLDDKQMDPSFVEMMSMLERILNYAHTGSAQVLIRGLMDRVWLSLGVIHDGLPAISSSFISYGSLTADS… |
| A0A0C9YWN7 | 9-381 | None |
| A0A1B7XQS9 | 3-361 | None |
| A0A3N4J6Y0 | 420-905 | None |
| A0A420N8S6 | 1-370 | None |
| A0A4Y9ZZK4 | 426-831 | None |
| A0A094AEX1 | 1-314 | None |
| X0KZ10 | 4-437 | None |
| A0A6A6U066 | 428-900 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.