DPCstruct | MC3636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.25 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9JXM3 | 2-59 | VVKPDQLIKRRGKLGLVGVNKTAAEVRRWLGEHMAKEQTIGACVGRLRHFIVEPFVKH |
| A0A2N5SZ86 | 19-83 | EKLVVKPDQLIKHRGQAGRLGLKKTWPKAQAWIQERAGKPVNVKGIVSTLNTFIVKPFAPHPSDT |
| S3BXP0 | 72-133 | None |
| A0A287QLS7 | 53-113 | None |
| A0A813UVU4 | 50-111 | None |
| H3A1H0 | 1-60 | None |
| M7YPN4 | 53-113 | None |
| A0A816IV61 | 697-758 | None |
| A0A3P7NS07 | 119-184 | None |
| G3HLV6 | 53-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.