DPCstruct | MC36357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 490 |
|---|---|
| Mean domain length (aa) | 323 ± 76 aa |
| Standard deviation of domain lengths | 76.43 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.28 |
| Pfam Score | 94.09 |
| Assigned Pfam label(s) | CL0552- PF05699- CL0012- CL0016- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5MLS4 | 64-358 | YVRDFKAKVQYFRFWCQVGLMPSEFEWLNRYFVFMHIKITVTRKTLFEDSFQQIMSFNAQDLRRRLWIIFPGEEGLDYGGVAREWFF… |
| A0A1A8LH26 | 3-306 | RASICRIKVVDDLLAVFTDSSIMNVTLKMDFVNEKAIDDAGVSREVYTAFWEQVLEQCEGEMERVPRLRPDFSEAEWQAVGRIWVKG… |
| A0A7M5UUV6 | 338-678 | None |
| A0A4S8N003 | 604-1030 | None |
| K3WX59 | 431-732 | None |
| G0P4C2 | 613-1081 | None |
| A0A7J6D7Y1 | 214-458 | None |
| A0A7J6D563 | 36-412 | None |
| A0A6A6L1E4 | 215-496 | None |
| A0A812KH71 | 115-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.