DPCstruct | MC36355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 228 ± 38 aa |
| Standard deviation of domain lengths | 38.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9Y2P3 | 1-194 | METTGETLKTTTPSKSPHLPWEHDFFIYNGVVDKTAPDFVAFKEHFSLSWGSIFSLLEHIQRFLRDYAIPEVKIKGNSLAALLPEFE… |
| A0A819FRZ8 | 280-499 | KLPSNRIKKGNLSRPLPTPELMSDNKNVYHLVIQDGVTKDQTEIFLQYRQFYCFIWGSIVKIFRLLEKLMYNYFVPIALINGEKVAE… |
| A0A183LFP6 | 251-469 | None |
| A0A226PC71 | 210-428 | None |
| A0A1R2CSS8 | 195-381 | None |
| A0A3B4A669 | 38-312 | None |
| A0A7J8JVE9 | 11-335 | None |
| A0A7M5X0I4 | 346-533 | None |
| L9KIQ8 | 116-389 | None |
| A0A4W5MG44 | 1-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.