DPCstruct | MC36350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 260 ± 39 aa |
| Standard deviation of domain lengths | 38.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2E547 | 1-208 | MCVCVCVCVCVCVLCRVCELEELGELSACWENLRRQIITQYQTIILTYQETISDLHEYKGPSFKSSTLKAERKLEFIPTNLHIQRMR… |
| A0A0P7V9S9 | 1-229 | MSRMYRFPTTDGNHLRILEQMAESVLSVNVPRQFVKLLLEEDAARVCELEELGELSPCWENLRRQIITQYQTIILTYQETLADLHEY… |
| A0A6A5FE22 | 377-701 | None |
| Q3LAC4 | 782-1040 | None |
| A0A6I9Q0D7 | 125-451 | None |
| A0A6I9X6E9 | 223-513 | None |
| A0A4W3JVN5 | 98-315 | None |
| A0A1Y1XRQ6 | 65-314 | None |
| A0A4Z2IAY6 | 41-335 | None |
| A0A336MS64 | 300-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.