DPCstruct | MC36349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06337 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5M5W3 | 1-66 | MTEPSLLQFYVSRQWLNKFKTFAEPGPISNDDFLCSHGGVPPAKAAFIDDLVVMLPQNVWDHLYSR |
| A0A2D4I2F7 | 464-540 | AKKKRERVSSLNVMEPSLLQFYISRLWLNKFRTFAEPGSISNNDFLCIHGGVPPHKASFIEDLVVMLPQNIWDNLYS |
| A0A7J7JFU7 | 498-575 | None |
| T1GIP2 | 229-305 | None |
| H2YH40 | 2-78 | None |
| A0A7R8YVW0 | 635-714 | None |
| W2TKM0 | 264-341 | None |
| A0A0C2GTU3 | 416-493 | None |
| A0A2H1CJW1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.