DPCstruct | MC36339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 456 |
|---|---|
| Mean domain length (aa) | 208 ± 42 aa |
| Standard deviation of domain lengths | 42.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0023- CL0020- CL0182- CL0582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2VCM3 | 134-323 | KSYIALFALVLMITLLVFNIVPGAVAALIAAGIILITQCVPLTKAYKGISWISVIMIAAMIPMGIALQKTGTATMIANGLVNSLGAL… |
| A0A6I3J6Z5 | 100-355 | FAFATLWLANGASLLLPISNLTNLLAVERTGQSAGAFVADLWLPQLVVLAVVVAVLALRHRAALAGTYVVPRTRPSYDAVLVAGGAL… |
| A0A6T7IR04 | 81-311 | None |
| A0A1U7VYP7 | 126-341 | None |
| A0A7T1HYH1 | 51-269 | None |
| A0A7G8T7P7 | 60-272 | None |
| A0A1V5ZQX9 | 66-424 | None |
| A0A7S2RJ39 | 542-742 | None |
| A0A1X6PK08 | 762-1010 | None |
| A0A2U8G2P1 | 232-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.