DPCstruct | MC36335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3W5Q1 | 25-126 | IKSANDPPRTLEELQARARLPSEPGYEDHHIVGQFAQNRQQFGSLRIDSPENTVRILVVKHLDINGYYSRANEQYDGRSPRDYLRGK… |
| A0A4Q0I419 | 1-87 | MGSPGEGNAWHHIVEQSQIKKSGFDPTQIHNTNNLIAVDKATHAKISGYYNTKSFDFTGGLSVRDWLAGQSFEAQYEFGLNVLKKFG |
| A0A3A8TCY8 | 65-173 | None |
| A0A7T2CTK4 | 203-297 | None |
| A0A1W9HRS3 | 206-323 | None |
| A0A1E5T2P5 | 12-113 | None |
| A0A1Q4DFN7 | 123-245 | None |
| A0A1F7VEI9 | 317-414 | None |
| A0A840SW73 | 83-183 | None |
| A0A0A6YB29 | 182-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.