DPCstruct | MC3633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CGP1 | 60-175 | VSGWIPMRSQDNNLSYRVWMHNFNDLPVRVDVQVKPQTGTDTDYVFPGIAAAQRDDSLKVPYGGIVYKYNKNSVTMYAPNKHSGEPS… |
| A0A8B6FVL3 | 153-266 | EPNFSKTFSMDTTVRYKTFNEVSHGLGKYPGMVSVRIQLDDGFMSDGQGVVFQSSPESSWQSLSGVLYGYDDANVRVWVPYKHSDDS… |
| K1PQ48 | 1-113 | None |
| A0A8B6F557 | 1-120 | None |
| K1Q4H9 | 26-146 | None |
| K1PUT8 | 2-98 | None |
| R7UPH6 | 28-165 | None |
| A0A8B6H6E2 | 10-150 | None |
| A0A8B6E0L8 | 24-160 | None |
| A0A8B6FLS8 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.