DPCstruct | MC36326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A353YEV7 | 29-140 | LKAEERGAEAAVASEGPQLDLDDLKARLDRSDRQAAMQALQLALSELGDGVTLVWQRPDRGLVGRIKPVSAFRDDKGRVCRHVVYSL… |
| B6IX95 | 1-86 | MDAADNAGLQGALRQVAAKPVDEVVGWANPDSGKRGAVKILRDGYDSDNRPCREFHSVVILDKLYQHATGFLCRQPDGAWEVADLR |
| A0A6M1LNN7 | 1-113 | None |
| A0A7Y3ECI3 | 99-199 | None |
| A0A2E6UPM8 | 40-168 | None |
| A0A509EFD0 | 30-138 | None |
| D5W9S2 | 1-86 | None |
| A0A849WSK3 | 51-162 | None |
| A0A7Y6YZB1 | 1-130 | None |
| A0A516H166 | 87-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.