DPCstruct | MC36325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068NMK8 | 130-214 | VQGGVMLMAQKSGAKLVPMGISARPRIFIKSWDRYMFPLPFGRGIFIFGEPLTVEKDADEAEVERVRLKLQEEIHRLEAEAERML |
| A0A349QHV0 | 2-74 | SGRPIVPAAYASSRRKDFVNAWDKASLNLPFSRASFVIGDPIFVDEDASEEHLEAKRQEVEAALNAVTEEAYR |
| A0A497T3V8 | 2-78 | None |
| A0A1F7LRB9 | 279-360 | None |
| A0A534ZPE5 | 12-90 | None |
| A0A2V7KX13 | 546-630 | None |
| A0A2H6HXM2 | 71-161 | None |
| A0A7V9PBN5 | 9-86 | None |
| A0A1Q6XEW0 | 16-99 | None |
| A0A2E1XWK5 | 284-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.