DPCstruct | MC36323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3YSA4 | 376-441 | FPYLLKELAEFVTLLPKEAQDVLLDDMHAHVAESDDVTRKPVLVSWLQSLSYISSQSSRSESRSKA |
| A0A2H5P2N3 | 2-97 | EELARRVVLSNLMKLLAQLIMKLPKDGQNLVLNELFSLVAESDDVTCKPTLVSWLQSLSYLCSQDTSRVANTTEVGGDRNSVSAQAT… |
| A0A287TDH0 | 37-122 | None |
| A0A6N2LPT3 | 2-73 | None |
| A0A2I0WBT5 | 28-118 | None |
| A0A453N2M3 | 1-86 | None |
| V4TEX2 | 260-348 | None |
| A0A200PMR2 | 176-255 | None |
| A0A2Z7ACT1 | 729-814 | None |
| A0A1P8AUZ1 | 492-561 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.