DPCstruct | MC3632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 83 ± 12 aa |
| Standard deviation of domain lengths | 11.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0028- CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846E5I7 | 1-66 | NYQPQPYPGRLLFFKAIDRNEINPPYPEKPWIEVSQGGLELHEIPGNHITMNYSPHVQILAEKVRP |
| A0A450ZN78 | 8-83 | NLQAAETYAPDRIPIPIILLRAGEYEIDDNFLPNEAVITADPSLGWNHLADSVEIHVMPGNHFTMMTEPHVRALLD |
| A0A4Q3BEE7 | 1-69 | None |
| A0A1E5A1K0 | 27-119 | None |
| A0A7K2XD43 | 7-95 | None |
| A0A537GG94 | 37-124 | None |
| A0A836WFF3 | 70-163 | None |
| A0A6M0GCK3 | 107-200 | None |
| A0A4Q3AUR0 | 3-95 | None |
| A0A4Q9J239 | 907-984 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.