DPCstruct | MC36319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14085 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A560HQ17 | 7-73 | MVKLSIPTDPADWHGVAMEHVWATPLGDDLYVLENSPGCAYGVSYRDIVVAQPEDGLLLFQRVHTHQ |
| A0A6F8TJ21 | 1-88 | MNNKKIVIDYLDKNNELSKELIWGEMCKTDQYFVRSIPFFAPNLAFNDLIQVEMDDKTLYFDDLIKPSNNSTLRIVFLNNDIKYIEKY |
| A0A2W2EHP3 | 15-94 | None |
| A0A160P1N0 | 4-71 | None |
| A0A7U3Y539 | 1-83 | None |
| A0A537MSU9 | 1-70 | None |
| A0A1F9BKT7 | 3-66 | None |
| A0A1I2I6B9 | 3-66 | None |
| A0A2V9DYS6 | 38-114 | None |
| A0A5J6ME46 | 106-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.