DPCstruct | MC36315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 173 ± 19 aa |
| Standard deviation of domain lengths | 18.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377YET3 | 70-221 | KSEDPRHLPTYLNEVITPSLVRIDKVRTNQASLSFQAMAGRDSLDQLLRLAELNQREVKRLSTLVAAHIDMIFIQLCGEMLTDELAS… |
| A0A156ZE54 | 1-148 | MGPRLERVNQLNGMNETASLLFLSERESYSRLACMSDKALKKFAARIASQLYVAYEELSDAWADAHGGKETLFTDEAQAHLYGHVAG… |
| A0A193QG77 | 14-200 | None |
| A0A3L1NQG9 | 392-568 | None |
| A0A377AVC7 | 3-199 | None |
| A0A376SBF8 | 40-238 | None |
| A0A6C8GF07 | 29-181 | None |
| A0A7H4SER4 | 4-155 | None |
| A0A379FY33 | 77-253 | None |
| C0B381 | 78-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.