DPCstruct | MC3631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03747 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R9J6F5 | 1-80 | MLGAIVGDIVGSVYEWNNIKTKDFPLFRKDCFFIDDTVMTCAVAEAIMNGGQKDDFIDAMKKYGRLYPNADYGARFNAWL |
| A0A450ZJG7 | 1-80 | MLDAIAGDIIDSVYEYDWNNIKTKAFELFSEAPFFTDDSVLTIALANAIIRKGDYGQMMSQYYNRYPHTGYGDSFQCSQR |
| A0A1T5F3J0 | 4-83 | None |
| A0A388P7V1 | 1-90 | None |
| A0A1C6EZR5 | 1-81 | None |
| R6YKI5 | 1-87 | None |
| R6XXV9 | 183-270 | None |
| A0A845UG29 | 1-83 | None |
| C9LS24 | 1-92 | None |
| K5ZEP5 | 201-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.