DPCstruct | MC36303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 272 ± 17 aa |
| Standard deviation of domain lengths | 17.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812U492 | 1-302 | MAAIPTGGALITSQCFNVAQDLVQRVLKTQNFTRQTLIKFLKILRDGQLHLQRTQTFLEGGKDAKARVEADPDLEKLFDLVQGHRTI… |
| A0A812N2F4 | 721-978 | WIACQLETMQAGQDWRQTWALGDGDSRTRIEQDPEGVRLAQILKASVRLRKALQTNADVQVGLSREELEEHAALLYFDIQAQYQPLL… |
| A0A812I727 | 166-458 | None |
| A0A812N730 | 1-245 | None |
| A0A1Q9C431 | 338-598 | None |
| A0A812VAL0 | 37-313 | None |
| A0A812JVU4 | 552-820 | None |
| A0A812RI65 | 216-485 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.