DPCstruct | MC36302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 167 ± 20 aa |
| Standard deviation of domain lengths | 20.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TRG9 | 103-278 | RDRVDCCSSQQGKMSRRQLLSSAACGFGSLALNWMLHRDATASEGLGLLGSPHAVPKVKSVIFLYMDGGPSQVDTFDPKPLLKKYDG… |
| A0A2E8GL43 | 1-146 | MKQLIHRREALRTIAGSFGSIAFAALATEQAWAESKQNPLAAKQPHFKPRAKHVIFLSMRGAPSHVDTFDYKPRLNADNGKQGKYGP… |
| A0A7Y5W748 | 1-158 | None |
| A0A517RC34 | 2-171 | None |
| A0A7C7Z897 | 4-166 | None |
| A0A7C8D9E5 | 1-127 | None |
| A0A2E8CYD1 | 2-159 | None |
| A0A2E7RUX0 | 1-116 | None |
| A0A4P5ZCS8 | 20-163 | None |
| A0A142X7U1 | 163-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.