DPCstruct | MC36300
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 209 ± 43 aa |
| Standard deviation of domain lengths | 43.24 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812R837 | 45-244 | IITEASSALTCRGMVGYPSADAASVPELVGMNEAATLRLTRTHPFWKRPYTGTIALRCGEIAEDVVQYLAMSEQTPASMGLSVEWDA… |
| A0A4Q3A9L9 | 15-213 | LKDFLAGITLHAVARPWAETIAWTVNLRAPRVNVFVTAGSGEEAVVGRLFTEDVREPDRHYFYSQTTSRNQPEPRLSTLEVDDRDPC… |
| A0A830HMA7 | 137-397 | None |
| A0A2P6NG91 | 62-307 | None |
| A0A7C5WJF2 | 2-133 | None |
| A0A7C3D2S2 | 10-185 | None |
| A0A2V2EHI0 | 42-254 | None |
| A0A7H0U0I9 | 1-181 | None |
| R1BSN7 | 7-176 | None |
| A0A7Y3DQY2 | 40-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.