DPCstruct | MC36298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 479 ± 114 aa |
| Standard deviation of domain lengths | 113.71 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QAZ6 | 51-512 | ILCLLCLTVWWLQILRELWSAVCFGEGCISLPTRTTRLTPTDSGSFRLTSISLSRKIFVVAVIVVRFAVAVTLGAVGTLFLLNTGSI… |
| A0A7S4VT25 | 79-564 | GVSLASRVCAQDRALSVASTQVTTLSEIDAYLGLDPRQLKTDGWGHGPMLCAVCVFLFAVLVLRELRSLLEFLRAMGALPRGRTRLE… |
| A0A812Y7F1 | 102-561 | None |
| A0A812XC14 | 2-369 | None |
| A0A812SYM6 | 41-458 | None |
| A0A1Q9E872 | 157-600 | None |
| A0A812MN63 | 445-773 | None |
| A0A812NEJ6 | 115-637 | None |
| A0A812ZSE1 | 2-365 | None |
| A0A812Z0I7 | 254-868 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.