DPCstruct | MC36297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 422 ± 98 aa |
| Standard deviation of domain lengths | 97.89 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 72.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813BR95 | 3-401 | KFEAESSKGTGGTTSWALLDSGATNPFRPANKGEEMEAMPIQVQLADGQAVLLRQNRAGTLMPYSKKQAAEKGTNTVIVPLGSLVQE… |
| A0A812Q088 | 38-476 | RAYLAEFEQLGYRRKSKEETGAQGPRIKAVEAAQGPRASEDHAEARGSVNVALAGETKVKMEQTRAGTILGEQGTQPIVPLGTLVKA… |
| A0A1Q9E556 | 66-649 | None |
| A0A812Z061 | 227-693 | None |
| A0A813ANL9 | 295-590 | None |
| A0A813BUM6 | 1-318 | None |
| A0A1Q9C0I9 | 201-755 | None |
| A0A812WQG6 | 1-744 | None |
| A0A812HPY5 | 644-978 | None |
| A0A812JXR6 | 285-699 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.